PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G13640.2
Common NameUNE16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 295aa    MW: 32115.3 Da    PI: 7.0877
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G13640.2genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.66.6e-343791155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt+eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  AT4G13640.2 37 KPRLRWTSELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRL 91
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-323493IPR009057Homeodomain-like
PROSITE profilePS5129411.5413494IPR017930Myb domain
SuperFamilySSF466894.84E-173693IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-243792IPR006447Myb domain, plants
PfamPF002491.6E-73989IPR001005SANT/Myb domain
PfamPF143794.8E-24135184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MYSAIRSSLP LDGSLGDYSD GTNLPIDACL VLTTDPKPRL RWTSELHERF VDAVTQLGGP  60
DKATPKTIMR TMGVKGLTLY HLKSHLQKFR LGRQSCKESI DNSKDVSCVA ESQDTGSSST  120
SSLRLAAQEQ NESYQVTEAL RAQMEVQRRL HEQLEYTQVQ RRLQLRIEAQ GKYLQSILEK  180
ACKAIEEQAV AFAGLEAARE ELSELAIKAS ITNGCQGTTS TFDTTKMMIP SLSELAVAIE  240
HKNNCSAESS LTSSTVGSPV SAALMKKRQR GVFGNGDSVV VGHDAGWVMP SSSIG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.221990.0floral meristem| flower| leaf| root| silique| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible254682_at0.0
Expression AtlasAT4G13640-
AtGenExpressAT4G13640-
ATTED-IIAT4G13640-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G13640.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G13640, AT4G00150, AT5G66770
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G13640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2264430.0AK226443.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL06-12-H15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001031626.10.0unfertilized embryo sac 16 protein / transcription factor
SwissprotQ9SAK57e-65APL_ARATH; Myb family transcription factor APL
TrEMBLF4JTR50.0F4JTR5_ARATH; Unfertilized embryo sac 16 protein / transcription factor
STRINGAT4G13640.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Representative plantOGRP7817262
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Pagnussat GC, et al.
    Genetic and molecular identification of genes required for female gametophyte development and function in Arabidopsis.
    Development, 2005. 132(3): p. 603-14
    [PMID:15634699]
  3. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  4. Klopffleisch K, et al.
    Arabidopsis G-protein interactome reveals connections to cell wall carbohydrates and morphogenesis.
    Mol. Syst. Biol., 2011. 7: p. 532
    [PMID:21952135]